PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 300aa    MW: 33590.4 Da    PI: 4.804
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29816genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM59.51.1e-182776151
       NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
              l pG+rFhPtdeelv++yL++kv+gk+l++ evi+e+diyk++PwdLpk++
  EMT29816 27 LLPGYRFHPTDEELVTFYLRRKVAGKPLSI-EVIREMDIYKHDPWDLPKAL 76
              579***************************.99**************9643 PP

2NAM31.64.8e-109312596128
       NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
               +g l+glkk+Lv+y g+  kg+ktdW+mhe+r+
  EMT29816  93 SGVLIGLKKSLVYYLGKFGKGTKTDWMMHEFRI 125
               56779**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-3426152IPR003441NAC domain
PROSITE profilePS5100518.22827153IPR003441NAC domain
PfamPF023652.9E-1529125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEMGKLISEE KVVLGGAGDE EEEDDVLLPG YRFHPTDEEL VTFYLRRKVA GKPLSIEVIR  60
EMDIYKHDPW DLPKALSGRP IYSAASGGSG SASGVLIGLK KSLVYYLGKF GKGTKTDWMM  120
HEFRIPPSAA AAANASQSTQ EAEVWTICRI FRRTITYRKQ QTWRTAPKPS AADQSSNTGS  180
FESSEVGHEY MNCLQAPAPT APCIPQQQHQ QYVSQMDAVN SNNFFYEDTM HNQQFQGQWN  240
AAPAAPEPEE KRQNTPSTAV SFHQTDHSHA VAEIDFYEVE GYLEEIARMM EVTDTAGFYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-282715915174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981565.11e-106PREDICTED: transcription factor JUNGBRUNNEN 1
TrEMBLM8D0X30.0M8D0X3_AEGTA; NAC domain-containing protein 42
STRINGMLOC_4952.11e-130(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-40NAC domain containing protein 42